PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G241200.1
Common NamePHAVU_007G241200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 122aa    MW: 14321.5 Da    PI: 10.7967
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G241200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.4e-1456101247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++WT+eE+  ++++ k  G+g+Wk I++    ++t+ q+ s+ qky
  Phvul.007G241200.1  56 KPWTEEEHRYFLCGLKNVGKGNWKEISKNYVRTKTPTQVASHAQKY 101
                         58*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.67450106IPR017930Myb domain
SuperFamilySSF466895.73E-1752106IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-1054100IPR009057Homeodomain-like
SMARTSM007171.1E-1054104IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.7E-1654104IPR006447Myb domain, plants
PfamPF002494.9E-1256101IPR001005SANT/Myb domain
CDDcd001673.67E-957102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MTFNRNSEDC LRLFGVNIVA KKPVTAADAE KDLNGAKSYI FLQRRHAFHD KKNKGKPWTE  60
EEHRYFLCGL KNVGKGNWKE ISKNYVRTKT PTQVASHAQK YFLRMSAFET RKRRRSLFDI  120
PL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110114RKRRR
2110115RKRRRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-89AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007145462.11e-88hypothetical protein PHAVU_007G241200g, partial
SwissprotQ8S9H72e-24DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLV7BLI51e-88V7BLI5_PHAVU; Uncharacterized protein (Fragment)
STRINGGLYMA10G23084.12e-55(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1686178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.19e-31MYB_related family protein